PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45116.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 355aa    MW: 39424.3 Da    PI: 8.0423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45116.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
       KHN45116.1 14 KGPWSPEEDTKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.23.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       KHN45116.1  69 GGFSEEEDNIICSLYVSIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.036962IPR017930Myb domain
SuperFamilySSF466891.36E-2611109IPR009057Homeodomain-like
SMARTSM007178.2E-131364IPR001005SANT/Myb domain
PfamPF002495.5E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001675.27E-101662No hitNo description
PROSITE profilePS5129420.8463117IPR017930Myb domain
SMARTSM007171.1E-1067115IPR001005SANT/Myb domain
PfamPF002496.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2370117IPR009057Homeodomain-like
CDDcd001672.34E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDTKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIRHGG FSEEEDNIIC SLYVSIGSRW SVIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
HRKELQARNK GNGGILKQEN SSSLLLQQNS AQQLHPCWPQ IPVLPLSSPY TNQSPSFNDQ  180
DSIRKLLIKL GGRFSDDYQP ILDGLNLQFP HGSNSLSSTQ QIQEEQVHVG SSALGCMNSI  240
GHNQVQFGQS NEYCAELVQG QGSFITTAIG EMVSSNDYSR RLLGGSLEFF YGEEMITDNK  300
IMGACASSSC GQSTNWGETS SSLMYPSLVA SNYEGVRQEM PRECAFQELS YPGAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527745.10.0PREDICTED: transcription factor RAX3
SwissprotQ9M2Y93e-88RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0B2SED30.0A0A0B2SED3_GLYSO; Transcription factor RAX3
TrEMBLA0A0R4J3G30.0A0A0R4J3G3_SOYBN; Uncharacterized protein
STRINGGLYMA06G05260.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-78myb domain protein 84
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]